PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000370G0800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 302aa    MW: 32925 Da    PI: 8.4954
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000370G0800genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353e-11153211563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a l++++
  PH01000370G0800 153 KRVKRVLANRQSAARSKERKTRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLEMQN 211
                      999***********************************************999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-16149213IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806151214IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.8E-11153204No hitNo description
PfamPF001701.3E-10153211IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-11153210No hitNo description
CDDcd147035.58E-23154205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDGIGDACAA ALMRRQQHHV QVQVQPGMSA VAPKPRAAGL PPTPPQEFGG HRAAGDVCME  60
DSTAGGGLPP RKAHRRSRSD VPFGYFPPSG RGGHQLPQPK VEAGWGHHGD GNGDDDLFNA  120
FSLEFGRGEF TPAETKKIVA DEKLAEMALA DPKRVKRVLA NRQSAARSKE RKTRYIAELE  180
QKVQILQTEA TTLSAQLTLL QRDSAGLEMQ NNELKFRLQA MEQQAQLRDA LNEALTAEVQ  240
RLKIATAELG DSCSSNSLAQ QIQLNAQNQM IQLQQQATPV PFYQLRQPQQ NGAAKNHESK  300
E*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281661e-151KJ728166.1 Zea mays clone pUT6436 bZIP transcription factor (bZIP64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.11e-106PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P43e-50RF2B_ORYSJ; Transcription factor RF2b
TrEMBLK4AAD41e-106K4AAD4_SETIT; Uncharacterized protein
STRINGSi035841m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-51bZIP family protein